Lineage for d1vkdd_ (1vkd D:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 565317Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 565323Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (4 families) (S)
  5. 565354Family b.67.2.4: TM1225-like predicted glycosylases [110284] (1 protein)
    Pfam 04041 DUF377
  6. 565355Protein Hypothetical protein TM1225 [110285] (1 species)
  7. 565356Species Thermotoga maritima [TaxId:243274] [110286] (1 PDB entry)
  8. 565360Domain d1vkdd_: 1vkd D: [108647]

Details for d1vkdd_

PDB Entry: 1vkd (more details), 2.1 Å

PDB Description: crystal structure of a predicted glycosidase (tm1225) from thermotoga maritima msb8 at 2.10 a resolution

SCOP Domain Sequences for d1vkdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkdd_ b.67.2.4 (D:) Hypothetical protein TM1225 {Thermotoga maritima}
mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
gaadthvalafgyideivdfvkrnsm

SCOP Domain Coordinates for d1vkdd_:

Click to download the PDB-style file with coordinates for d1vkdd_.
(The format of our PDB-style files is described here.)

Timeline for d1vkdd_: