Lineage for d1vkde_ (1vkd E:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468754Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 468760Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (4 families) (S)
  5. 468786Family b.67.2.4: TM1225-like predicted glycosylases [DUF377] (Pfam 04041) [110284] (1 protein)
  6. 468787Protein Hypothetical protein TM1225 [110285] (1 species)
  7. 468788Species Thermotoga maritima [TaxId:243274] [110286] (1 PDB entry)
  8. 468793Domain d1vkde_: 1vkd E: [108648]

Details for d1vkde_

PDB Entry: 1vkd (more details), 2.1 Å

PDB Description: crystal structure of a predicted glycosidase (tm1225) from thermotoga maritima msb8 at 2.10 a resolution

SCOP Domain Sequences for d1vkde_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkde_ b.67.2.4 (E:) Hypothetical protein TM1225 {Thermotoga maritima}
mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
gaadthvalafgyideivdfvkrns

SCOP Domain Coordinates for d1vkde_:

Click to download the PDB-style file with coordinates for d1vkde_.
(The format of our PDB-style files is described here.)

Timeline for d1vkde_: