Lineage for d1vfpb2 (1vfp B:344-360,B:600-750)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495850Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 495851Superfamily c.108.1: HAD-like [56784] (16 families) (S)
    contains an insert alpha+beta subdomain; similar overall fold to the Cof family
    usually contains an insertion (sub)domain after strand 1
  5. 495951Family c.108.1.7: Calcium ATPase, catalytic domain P [81656] (1 protein)
    interrupted by a large insertion, domain N
  6. 495952Protein Calcium ATPase, catalytic domain P [81655] (1 species)
  7. 495953Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81654] (6 PDB entries)
  8. 495958Domain d1vfpb2: 1vfp B:344-360,B:600-750 [108581]
    Other proteins in same PDB: d1vfpa1, d1vfpa3, d1vfpa4, d1vfpb1, d1vfpb3, d1vfpb4

Details for d1vfpb2

PDB Entry: 1vfp (more details), 2.9 Å

PDB Description: Crystal structure of the SR CA2+-ATPase with bound AMPPCP

SCOP Domain Sequences for d1vfpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfpb2 c.108.1.7 (B:344-360,B:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus)}
ctsvicsdktgtlttnqXldpprkevmgsiqlcrdagirvimitgdnkgtaiaicrrigi
fgeneevadraytgrefddlplaeqreacrraccfarvepshkskiveylqsydeitamt
gdgvndapalkkaeigiamgsgtavaktasemvladdnfstivaaveeg

SCOP Domain Coordinates for d1vfpb2:

Click to download the PDB-style file with coordinates for d1vfpb2.
(The format of our PDB-style files is described here.)

Timeline for d1vfpb2: