Lineage for d1vfpb4 (1vfp B:1-124,B:240-343,B:751-994)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 520638Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 520639Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) (S)
  5. 520640Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)
  6. 520641Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 520642Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (6 PDB entries)
  8. 520647Domain d1vfpb4: 1vfp B:1-124,B:240-343,B:751-994 [108583]
    Other proteins in same PDB: d1vfpa1, d1vfpa2, d1vfpa3, d1vfpb1, d1vfpb2, d1vfpb3

Details for d1vfpb4

PDB Entry: 1vfp (more details), 2.9 Å

PDB Description: Crystal structure of the SR CA2+-ATPase with bound AMPPCP

SCOP Domain Sequences for d1vfpb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfpb4 f.33.1.1 (B:1-124,B:240-343,B:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus)}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOP Domain Coordinates for d1vfpb4:

Click to download the PDB-style file with coordinates for d1vfpb4.
(The format of our PDB-style files is described here.)

Timeline for d1vfpb4: