Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins) Pfam PF03259 |
Protein MEK binding partner 1, MP1 [111120] (2 species) remote homolog that forms the characteristic complex structures with other members |
Species Mouse (Mus musculus) [TaxId:10090] [111122] (2 PDB entries) Uniprot O88653 |
Domain d1veua_: 1veu A: [108555] Other proteins in same PDB: d1veub1, d1veub2 |
PDB Entry: 1veu (more details), 2.15 Å
SCOPe Domain Sequences for d1veua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1veua_ d.110.7.1 (A:) MEK binding partner 1, MP1 {Mouse (Mus musculus) [TaxId: 10090]} ddlkrflykklpsveglhaivvsdrdgvpvikvandsapehalrpgflstfalatdqgsk lglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelikv
Timeline for d1veua_: