Lineage for d1veua_ (1veu A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2577625Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 2577626Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
    Pfam PF03259
  6. 2577649Protein MEK binding partner 1, MP1 [111120] (2 species)
    remote homolog that forms the characteristic complex structures with other members
  7. 2577654Species Mouse (Mus musculus) [TaxId:10090] [111122] (2 PDB entries)
    Uniprot O88653
  8. 2577656Domain d1veua_: 1veu A: [108555]
    Other proteins in same PDB: d1veub1, d1veub2

Details for d1veua_

PDB Entry: 1veu (more details), 2.15 Å

PDB Description: Crystal structure of the p14/MP1 complex at 2.15 A resolution
PDB Compounds: (A:) Mitogen-activated protein kinase kinase 1 interacting protein 1

SCOPe Domain Sequences for d1veua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veua_ d.110.7.1 (A:) MEK binding partner 1, MP1 {Mouse (Mus musculus) [TaxId: 10090]}
ddlkrflykklpsveglhaivvsdrdgvpvikvandsapehalrpgflstfalatdqgsk
lglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelikv

SCOPe Domain Coordinates for d1veua_:

Click to download the PDB-style file with coordinates for d1veua_.
(The format of our PDB-style files is described here.)

Timeline for d1veua_: