Lineage for d1veua_ (1veu A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509664Fold d.110: Profilin-like [55769] (7 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 509889Superfamily d.110.7: Roadblock/LC7 domain [103196] (1 family) (S)
    alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices
  5. 509890Family d.110.7.1: Roadblock/LC7 domain [103197] (3 proteins)
    Pfam 03259
  6. 509902Protein MEK binding partner 1, MP1 [111120] (2 species)
    remote homolog that forms the characteristic complex structures with other members
  7. 509905Species Mouse (Mus musculus) [TaxId:10090] [111122] (2 PDB entries)
  8. 509907Domain d1veua_: 1veu A: [108555]
    Other proteins in same PDB: d1veub_

Details for d1veua_

PDB Entry: 1veu (more details), 2.15 Å

PDB Description: Crystal structure of the p14/MP1 complex at 2.15 A resolution

SCOP Domain Sequences for d1veua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veua_ d.110.7.1 (A:) MEK binding partner 1, MP1 {Mouse (Mus musculus)}
ddlkrflykklpsveglhaivvsdrdgvpvikvandsapehalrpgflstfalatdqgsk
lglsknksiicyyntyqvvqfnrlplvvsfiasssantglivslekelaplfeelikv

SCOP Domain Coordinates for d1veua_:

Click to download the PDB-style file with coordinates for d1veua_.
(The format of our PDB-style files is described here.)

Timeline for d1veua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1veub_