![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.13: SpoIIaa-like [52086] (2 superfamilies) core: 4 turns of a (beta-alpha)n superhelix |
![]() | Superfamily c.13.2: SpoIIaa-like [52091] (3 families) ![]() |
![]() | Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein) automatically mapped to Pfam PF01740 |
![]() | Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [110449] (3 PDB entries) Uniprot Q9X1F5; TM1442 |
![]() | Domain d1vc1b_: 1vc1 B: [108494] |
PDB Entry: 1vc1 (more details), 2 Å
SCOPe Domain Sequences for d1vc1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vc1b_ c.13.2.1 (B:) Anti-sigma factor antagonist SpoIIaa {Thermotoga maritima [TaxId: 2336]} mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsa glgtlvvilkdakingkefilsslkesisrilklthldkifkitdtveea
Timeline for d1vc1b_: