Lineage for d1vc1a_ (1vc1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852201Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2852253Superfamily c.13.2: SpoIIaa-like [52091] (3 families) (S)
  5. 2852254Family c.13.2.1: Anti-sigma factor antagonist SpoIIaa [52092] (1 protein)
    automatically mapped to Pfam PF01740
  6. 2852255Protein Anti-sigma factor antagonist SpoIIaa [52093] (4 species)
  7. 2852274Species Thermotoga maritima [TaxId:2336] [110449] (3 PDB entries)
    Uniprot Q9X1F5; TM1442
  8. 2852275Domain d1vc1a_: 1vc1 A: [108493]

Details for d1vc1a_

PDB Entry: 1vc1 (more details), 2 Å

PDB Description: Crystal structure of the TM1442 protein from Thermotoga maritima, a homolog of the Bacillus subtilis general stress response anti-anti-sigma factor RsbV
PDB Compounds: (A:) Putative anti-sigma factor antagonist TM1442

SCOPe Domain Sequences for d1vc1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vc1a_ c.13.2.1 (A:) Anti-sigma factor antagonist SpoIIaa {Thermotoga maritima [TaxId: 2336]}
mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsa
glgtlvvilkdakingkefilsslkesisrilklthldkifkitdtveea

SCOPe Domain Coordinates for d1vc1a_:

Click to download the PDB-style file with coordinates for d1vc1a_.
(The format of our PDB-style files is described here.)

Timeline for d1vc1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vc1b_