PDB entry 1vc1

View 1vc1 on RCSB PDB site
Description: Crystal structure of the TM1442 protein from Thermotoga maritima, a homolog of the Bacillus subtilis general stress response anti-anti-sigma factor RsbV
Class: gene regulation
Keywords: anti-anti-sigma factor, gene regulation
Deposited on 2004-03-03, released 2004-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.205
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative anti-sigma factor antagonist TM1442
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1442
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vc1a_
  • Chain 'B':
    Compound: Putative anti-sigma factor antagonist TM1442
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1442
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vc1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vc1A (A:)
    mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsa
    glgtlvvilkdakingkefilsslkesisrilklthldkifkitdtveea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vc1B (B:)
    mnnlkldiveqddkaivrvqgdidaynsselkeqlrnfisttskkkivldlssvsymdsa
    glgtlvvilkdakingkefilsslkesisrilklthldkifkitdtveea