Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.12: Haloperoxidase [53531] (8 proteins) |
Protein Arylesterase [110695] (1 species) haloperoxidase homologue |
Species Pseudomonas fluorescens [TaxId:294] [110696] (1 PDB entry) Uniprot P22862 |
Domain d1va4a_: 1va4 A: [108458] complexed with gol |
PDB Entry: 1va4 (more details), 1.8 Å
SCOPe Domain Sequences for d1va4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg aelkvykdaphgfavthaqqlnedllaflkr
Timeline for d1va4a_: