Lineage for d1va4a_ (1va4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900586Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2900587Protein Arylesterase [110695] (1 species)
    haloperoxidase homologue
  7. 2900588Species Pseudomonas fluorescens [TaxId:294] [110696] (1 PDB entry)
    Uniprot P22862
  8. 2900589Domain d1va4a_: 1va4 A: [108458]
    complexed with gol

Details for d1va4a_

PDB Entry: 1va4 (more details), 1.8 Å

PDB Description: Pseudomonas fluorescens aryl esterase
PDB Compounds: (A:) Arylesterase

SCOPe Domain Sequences for d1va4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]}
stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
aelkvykdaphgfavthaqqlnedllaflkr

SCOPe Domain Coordinates for d1va4a_:

Click to download the PDB-style file with coordinates for d1va4a_.
(The format of our PDB-style files is described here.)

Timeline for d1va4a_: