PDB entry 1va4

View 1va4 on RCSB PDB site
Description: Pseudomonas fluorescens aryl esterase
Class: hydrolase
Keywords: alpha/beta hydrolase, esterase, non-cofactor dependent haloperoxidase, HYDROLASE
Deposited on 2004-02-11, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arylesterase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1va4a_
  • Chain 'B':
    Compound: Arylesterase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1va4b_
  • Chain 'C':
    Compound: Arylesterase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1va4c_
  • Chain 'D':
    Compound: Arylesterase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1va4d_
  • Chain 'E':
    Compound: Arylesterase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1va4e_
  • Chain 'F':
    Compound: Arylesterase
    Species: Pseudomonas fluorescens [TaxId:294]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1va4f_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1va4A (A:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va4A (A:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1va4B (B:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va4B (B:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1va4C (C:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va4C (C:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1va4D (D:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va4D (D:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1va4E (E:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va4E (E:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1va4F (F:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkrgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va4F (F:)
    stfvakdgtqiyfkdwgsgkpvlfshgwlldadmweyqmeylssrgyrtiafdrrgfgrs
    dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
    vtplfgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
    qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
    aelkvykdaphgfavthaqqlnedllaflkr