| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
| Protein Glia maturation factor beta, GMF-beta [111108] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [111109] (1 PDB entry) Uniprot Q9CQI3 |
| Domain d1v6fa_: 1v6f A: [108395] |
PDB Entry: 1v6f (more details)
SCOPe Domain Sequences for d1v6fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6fa_ d.109.1.2 (A:) Glia maturation factor beta, GMF-beta {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgseslvvcdvaedlveklrkfrfrkethnaaiimkidkderlvvldeelegvsp
delkdelperqprfivysykyqhddgrvsyplcfifsspvgckpeqqmmyagsknklvqt
aeltkvfeirntedlteewlreklgsgpssg
Timeline for d1v6fa_: