Lineage for d1v6fa1 (1v6f A:8-145)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534201Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2534202Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2534346Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2534389Protein Glia maturation factor beta, GMF-beta [111108] (1 species)
  7. 2534390Species Mouse (Mus musculus) [TaxId:10090] [111109] (1 PDB entry)
    Uniprot Q9CQI3
  8. 2534391Domain d1v6fa1: 1v6f A:8-145 [108395]
    Other proteins in same PDB: d1v6fa2, d1v6fa3

Details for d1v6fa1

PDB Entry: 1v6f (more details)

PDB Description: Solution Structure of Glia Maturation Factor-beta from Mus Musculus
PDB Compounds: (A:) glia maturation factor, beta

SCOPe Domain Sequences for d1v6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6fa1 d.109.1.2 (A:8-145) Glia maturation factor beta, GMF-beta {Mouse (Mus musculus) [TaxId: 10090]}
seslvvcdvaedlveklrkfrfrkethnaaiimkidkderlvvldeelegvspdelkdel
perqprfivysykyqhddgrvsyplcfifsspvgckpeqqmmyagsknklvqtaeltkvf
eirntedlteewlreklg

SCOPe Domain Coordinates for d1v6fa1:

Click to download the PDB-style file with coordinates for d1v6fa1.
(The format of our PDB-style files is described here.)

Timeline for d1v6fa1: