Lineage for d1v1pb2 (1v1p B:109-213)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934370Protein Exotoxin 1 (SET1, Superantigen-like protein 7) [110810] (1 species)
  7. 2934371Species Staphylococcus aureus [TaxId:1280] [110811] (2 PDB entries)
    Uniprot Q9ZFS5 36-231
  8. 2934375Domain d1v1pb2: 1v1p B:109-213 [108271]
    Other proteins in same PDB: d1v1pa1, d1v1pb1

Details for d1v1pb2

PDB Entry: 1v1p (more details), 2.7 Å

PDB Description: the structure ssl from staphylococcus aureus from an orthorhombic crystal form
PDB Compounds: (B:) exotoxin 1

SCOPe Domain Sequences for d1v1pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1pb2 d.15.6.1 (B:109-213) Exotoxin 1 (SET1, Superantigen-like protein 7) {Staphylococcus aureus [TaxId: 1280]}
nktsetntplfvnkvngedldasidsfliqkeeislkeldfkirqqlvnnyglykgtsky
gkiiinlkdenkveidlgdklqfermgdvlnskdirgisvtinqi

SCOPe Domain Coordinates for d1v1pb2:

Click to download the PDB-style file with coordinates for d1v1pb2.
(The format of our PDB-style files is described here.)

Timeline for d1v1pb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v1pb1