Lineage for d1v1pb1 (1v1p B:23-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2788949Protein Exotoxin 1 (SET1, Superantigen-like protein 7) [110190] (1 species)
  7. 2788950Species Staphylococcus aureus [TaxId:1280] [110191] (2 PDB entries)
    Uniprot Q9ZFS5 36-231
  8. 2788954Domain d1v1pb1: 1v1p B:23-108 [108270]
    Other proteins in same PDB: d1v1pa2, d1v1pb2

Details for d1v1pb1

PDB Entry: 1v1p (more details), 2.7 Å

PDB Description: the structure ssl from staphylococcus aureus from an orthorhombic crystal form
PDB Compounds: (B:) exotoxin 1

SCOPe Domain Sequences for d1v1pb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v1pb1 b.40.2.2 (B:23-108) Exotoxin 1 (SET1, Superantigen-like protein 7) {Staphylococcus aureus [TaxId: 1280]}
hdirdlhryyssesfeysnvsgkvenyngsnvvrfnpkdqnhqlfllgkdkeqykeglqg
qnvfvvqelidpngrlstvggvtkkn

SCOPe Domain Coordinates for d1v1pb1:

Click to download the PDB-style file with coordinates for d1v1pb1.
(The format of our PDB-style files is described here.)

Timeline for d1v1pb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v1pb2