![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Exotoxin 1 (SET1, Superantigen-like protein 7) [110810] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [110811] (2 PDB entries) Uniprot Q9ZFS5 36-231 |
![]() | Domain d1v1pb2: 1v1p B:109-213 [108271] Other proteins in same PDB: d1v1pa1, d1v1pb1 |
PDB Entry: 1v1p (more details), 2.7 Å
SCOPe Domain Sequences for d1v1pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v1pb2 d.15.6.1 (B:109-213) Exotoxin 1 (SET1, Superantigen-like protein 7) {Staphylococcus aureus [TaxId: 1280]} nktsetntplfvnkvngedldasidsfliqkeeislkeldfkirqqlvnnyglykgtsky gkiiinlkdenkveidlgdklqfermgdvlnskdirgisvtinqi
Timeline for d1v1pb2: