SCOPe 2.04: Domain d1v1pb1: 1v1p B:23-108

Lineage for d1v1pb1 (1v1p B:23-108)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Exotoxin 1 (SET1, Superantigen-like protein 7) [110190] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [110191] (2 PDB entries)
   Uniprot Q9ZFS5 36-231

8. Domain d1v1pb1: 1v1p B:23-108 [108270]
   Other proteins in same PDB: d1v1pa2, d1v1pb2

Details for d1v1pb1

PDB Entry: 1v1p, 2.7 Å

PDB Description: the structure ssl from staphylococcus aureus from an orthorhombic crystal form

PDB Compounds: (B:) exotoxin 1

SCOPe Domain Sequences for d1v1pb1:

Sequence; same for both SEQRES and ATOM records:

>d1v1pb1 b.40.2.2 (B:23-108) Exotoxin 1 (SET1, Superantigen-like protein 7) {Staphylococcus aureus [TaxId: 1280]}
hdirdlhryyssesfeysnvsgkvenyngsnvvrfnpkdqnhqlfllgkdkeqykeglqg
qnvfvvqelidpngrlstvggvtkkn

Timeline for d1v1pb1:

• d1v1pb1 first appeared in SCOP 1.69
  
• d1v1pb1 appears in SCOPe 2.03
  
• d1v1pb1 appears in SCOPe 2.05
  
• d1v1pb1 appears in the current release, SCOPe 2.08