Lineage for d1v0na_ (1v0n A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819321Protein Xylanase A, catalytic core [51514] (8 species)
  7. 1819366Species Streptomyces lividans [TaxId:1916] [51515] (9 PDB entries)
    Uniprot P26514 43-344
  8. 1819371Domain d1v0na_: 1v0n A: [108209]
    complexed with edo, imd

Details for d1v0na_

PDB Entry: 1v0n (more details), 1.1 Å

PDB Description: xylanase xyn10a from streptomyces lividans in complex with xylobio- isofagomine at ph 7.5
PDB Compounds: (A:) Endo-1,4-beta-xylanase A

SCOPe Domain Sequences for d1v0na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v0na_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]}
aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgsalrqamidhingvmahykgki
vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavldal
ng

SCOPe Domain Coordinates for d1v0na_:

Click to download the PDB-style file with coordinates for d1v0na_.
(The format of our PDB-style files is described here.)

Timeline for d1v0na_: