Lineage for d1v02e_ (1v02 E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083019Protein Plant beta-glucosidase (myrosinase) [51522] (4 species)
  7. 2083041Species Sorghum (Sorghum bicolor) [TaxId:4558] [110351] (2 PDB entries)
    Uniprot Q41290
  8. 2083046Domain d1v02e_: 1v02 E: [108198]

Details for d1v02e_

PDB Entry: 1v02 (more details), 1.9 Å

PDB Description: crystal structure of the sorghum bicolor dhurrinase 1
PDB Compounds: (E:) dhurrinase

SCOPe Domain Sequences for d1v02e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v02e_ c.1.8.4 (E:) Plant beta-glucosidase (myrosinase) {Sorghum (Sorghum bicolor) [TaxId: 4558]}
rlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrsngd
vaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidllle
ngiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgkkvknwltfnepet
fcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkgadg
riglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvpyfk
ekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaigppt
gnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldyiqr
hlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsarwlq
efng

SCOPe Domain Coordinates for d1v02e_:

Click to download the PDB-style file with coordinates for d1v02e_.
(The format of our PDB-style files is described here.)

Timeline for d1v02e_: