PDB entry 1v02

View 1v02 on RCSB PDB site
Description: crystal structure of the sorghum bicolor dhurrinase 1
Class: hydrolase
Keywords: beta-glucosidase, dhurrin hydrolysis, pest defense, family gh1, hydrolase
Deposited on 2004-03-22, released 2004-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dhurrinase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41290
      • conflict (169)
      • conflict (211-213)
      • conflict (230)
    Domains in SCOPe 2.07: d1v02a_
  • Chain 'B':
    Compound: dhurrinase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41290
      • conflict (169)
      • conflict (211-213)
      • conflict (230)
    Domains in SCOPe 2.07: d1v02b_
  • Chain 'C':
    Compound: dhurrinase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41290
      • conflict (169)
      • conflict (211-213)
      • conflict (230)
    Domains in SCOPe 2.07: d1v02c_
  • Chain 'D':
    Compound: dhurrinase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41290
      • conflict (169)
      • conflict (211-213)
      • conflict (230)
    Domains in SCOPe 2.07: d1v02d_
  • Chain 'E':
    Compound: dhurrinase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Domains in SCOPe 2.07: d1v02e_
  • Chain 'F':
    Compound: dhurrinase
    Species: SORGHUM BICOLOR [TaxId:4558]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q41290
      • conflict (169)
      • conflict (211-213)
      • conflict (230)
    Domains in SCOPe 2.07: d1v02f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v02A (A:)
    malllasainhtahpaglrshpnnesfsrhhlcsspqniskrrsnlsfrpraqtissesa
    gihrlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrs
    ngdvaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidl
    llengiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfne
    petfcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkg
    adgriglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvp
    yfkekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaig
    pptgnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldy
    iqrhlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsar
    wlqefngaakkvennkiltpagqln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v02A (A:)
    rlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrsngd
    vaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidllle
    ngiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfnepet
    fcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkgadg
    riglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvpyfk
    ekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaigppt
    gnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldyiqr
    hlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsarwlq
    efng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v02B (B:)
    malllasainhtahpaglrshpnnesfsrhhlcsspqniskrrsnlsfrpraqtissesa
    gihrlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrs
    ngdvaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidl
    llengiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfne
    petfcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkg
    adgriglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvp
    yfkekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaig
    pptgnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldy
    iqrhlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsar
    wlqefngaakkvennkiltpagqln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v02B (B:)
    rlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrsngd
    vaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidllle
    ngiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfnepet
    fcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkgadg
    riglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvpyfk
    ekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaigppt
    gnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldyiqr
    hlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsarwlq
    efng
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v02C (C:)
    malllasainhtahpaglrshpnnesfsrhhlcsspqniskrrsnlsfrpraqtissesa
    gihrlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrs
    ngdvaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidl
    llengiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfne
    petfcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkg
    adgriglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvp
    yfkekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaig
    pptgnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldy
    iqrhlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsar
    wlqefngaakkvennkiltpagqln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v02C (C:)
    rlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrsngd
    vaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidllle
    ngiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfnepet
    fcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkgadg
    riglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvpyfk
    ekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaigppt
    gnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldyiqr
    hlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsarwlq
    efng
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v02D (D:)
    malllasainhtahpaglrshpnnesfsrhhlcsspqniskrrsnlsfrpraqtissesa
    gihrlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrs
    ngdvaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidl
    llengiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfne
    petfcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkg
    adgriglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvp
    yfkekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaig
    pptgnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldy
    iqrhlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsar
    wlqefngaakkvennkiltpagqln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v02D (D:)
    rlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrsngd
    vaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidllle
    ngiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfnepet
    fcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkgadg
    riglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvpyfk
    ekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaigppt
    gnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldyiqr
    hlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsarwlq
    efng
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1v02E (E:)
    malllasainhtahpaglrshpnnesfsrhhlcsspqniskrrsnlsfrpraqtissesa
    gihrlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrs
    ngdvaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidl
    llengiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgkkvknwltfne
    petfcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkg
    adgriglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvp
    yfkekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaig
    pptgnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldy
    iqrhlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsar
    wlqefngaakkvennkiltpagqln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v02E (E:)
    rlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrsngd
    vaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidllle
    ngiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgkkvknwltfnepet
    fcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkgadg
    riglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvpyfk
    ekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaigppt
    gnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldyiqr
    hlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsarwlq
    efng
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1v02F (F:)
    malllasainhtahpaglrshpnnesfsrhhlcsspqniskrrsnlsfrpraqtissesa
    gihrlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrs
    ngdvaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidl
    llengiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfne
    petfcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkg
    adgriglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvp
    yfkekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaig
    pptgnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldy
    iqrhlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsar
    wlqefngaakkvennkiltpagqln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v02F (F:)
    rlspweiprrdwfppsflfgaatsayqiegawnedgkgpstwdhfchnfpewivdrsngd
    vaadsyhmyaedvrllkemgmdayrfsiswprilpkgtlagginekrveyynklidllle
    ngiepyitifhwdtpqalvdayggflderiikdytdfakvcfekfgktvknwltfnepet
    fcsvsygtgvlapgrcspgvscavptgnslsepyivahnllrahaetvdiynkyhkgadg
    riglalnvfgrvpytntfldqqaqersmdkclgwflepvvrgdypfsmrvsardrvpyfk
    ekeqeklvgsydmiginyytstfskhidlspnnspvlntddayasqetkgpdgnaigppt
    gnawinmypkglhdilmtmknkygnppmyitengmgdidkgdlpkpvaledhtrldyiqr
    hlsvlkqsidlgadvrgyfawslldnfewssgyterfgivyvdrengcertmkrsarwlq
    efng