Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins) |
Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species) |
Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries) Uniprot P08095 |
Domain d1uupc2: 1uup C:3108-3221 [108055] Other proteins in same PDB: d1uupa1, d1uupb1, d1uupc1, d1uupd1 complexed with zn |
PDB Entry: 1uup (more details), 2.6 Å
SCOPe Domain Sequences for d1uupc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uupc2 d.15.6.1 (C:3108-3221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]} gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk
Timeline for d1uupc2: