Lineage for d1uupa2 (1uup A:1108-1221)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195863Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) (S)
  5. 1195864Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (15 proteins)
  6. 1195943Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)
  7. 1195944Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
    Uniprot P08095
  8. 1195951Domain d1uupa2: 1uup A:1108-1221 [108051]
    Other proteins in same PDB: d1uupa1, d1uupb1, d1uupc1, d1uupd1
    complexed with zn

Details for d1uupa2

PDB Entry: 1uup (more details), 2.6 Å

PDB Description: crystal structure of a dimeric form of streptococcal pyrogenic exotoxin a (spea1).
PDB Compounds: (A:) exotoxin type a

SCOPe Domain Sequences for d1uupa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uupa2 d.15.6.1 (A:1108-1221) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkyltdnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldsntsqievylttk

SCOPe Domain Coordinates for d1uupa2:

Click to download the PDB-style file with coordinates for d1uupa2.
(The format of our PDB-style files is described here.)

Timeline for d1uupa2: