Class b: All beta proteins [48724] (177 folds) |
Fold b.147: BTV NS2-like ssRNA-binding domain [110131] (1 superfamily) sandwich; 9 strands in 2 sheets; unusual topology with 2 crossover loops |
Superfamily b.147.1: BTV NS2-like ssRNA-binding domain [110132] (1 family) automatically mapped to Pfam PF04514 |
Family b.147.1.1: BTV NS2-like ssRNA-binding domain [110133] (1 protein) N-terminal half of Pfam PF04514 |
Protein Nonstructural protein NS2 [110134] (1 species) |
Species Bluetongue virus [TaxId:40051] [110135] (1 PDB entry) Uniprot P23065 8-160 |
Domain d1utya_: 1uty A: [108036] |
PDB Entry: 1uty (more details), 2.4 Å
SCOPe Domain Sequences for d1utya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utya_ b.147.1.1 (A:) Nonstructural protein NS2 {Bluetongue virus [TaxId: 40051]} ftknifvldvtaktlcgaiaklssqpycqikigrvvafkpvknpepkgyvlnvpgpgayr iqdgqdiislmltphgveatterweewkfegvsvtpmatrvqyngvmvdaeikyckgmgi vqpymrndfdrnempdlpgvmrsnydirelrqk
Timeline for d1utya_: