SCOP 1.69: Domain d1utya_: 1uty A:

Lineage for d1utya_ (1uty A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.147: BTV NS2-like ssRNA-binding domain (N-terminal half of Pfam 04514) [110131] (1 superfamily)
   sandwich; 9 strands in 2 sheets; unusual topology with 2 crossover loops

4. Superfamily b.147.1: BTV NS2-like ssRNA-binding domain (N-terminal half of Pfam 04514) [110132] (1 family)

5. Family b.147.1.1: BTV NS2-like ssRNA-binding domain (N-terminal half of Pfam 04514) [110133] (1 protein)

6. Protein Nonstructural protein NS2 [110134] (1 species)

7. Species Bluetongue virus [TaxId:40051] [110135] (1 PDB entry)

8. Domain d1utya_: 1uty A: [108036]

Details for d1utya_

PDB Entry: 1uty, 2.4 Å

PDB Description: crystal structure of the rna binding domain of bluetongue virus non- structural protein 2(ns2)

SCOP Domain Sequences for d1utya_:

Sequence; same for both SEQRES and ATOM records:

>d1utya_ b.147.1.1 (A:) Nonstructural protein NS2 {Bluetongue virus}
ftknifvldvtaktlcgaiaklssqpycqikigrvvafkpvknpepkgyvlnvpgpgayr
iqdgqdiislmltphgveatterweewkfegvsvtpmatrvqyngvmvdaeikyckgmgi
vqpymrndfdrnempdlpgvmrsnydirelrqk

Timeline for d1utya_:

• d1utya_ is new in SCOP 1.69
  
• d1utya_ appears in SCOP 1.71
  
• d1utya_ appears in the current release, SCOPe 2.08