Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein LysR-type regulatory protein DntR [110748] (1 species) |
Species Burkholderia sp. [TaxId:36773] [110749] (2 PDB entries) Uniprot Q7WT50 75-301 |
Domain d1utha1: 1uth A:86-301 [108032] Other proteins in same PDB: d1utha2 complexed with scn |
PDB Entry: 1uth (more details), 2.2 Å
SCOPe Domain Sequences for d1utha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utha1 c.94.1.1 (A:86-301) LysR-type regulatory protein DntR {Burkholderia sp. [TaxId: 36773]} trnsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesg avdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfselehvgvvalntg hgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphp aklpdiainlfwhakynrdpgnmwlrqlfvelfsea
Timeline for d1utha1: