Lineage for d1uthb_ (1uth B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914386Protein LysR-type regulatory protein DntR [110748] (1 species)
  7. 2914387Species Burkholderia sp. [TaxId:36773] [110749] (2 PDB entries)
    Uniprot Q7WT50 75-301
  8. 2914389Domain d1uthb_: 1uth B: [108033]
    Other proteins in same PDB: d1utha2
    complexed with scn

Details for d1uthb_

PDB Entry: 1uth (more details), 2.2 Å

PDB Description: dntr from burkholderia sp. strain dnt in complex with thiocyanate
PDB Compounds: (B:) LysR-type regulatory protein

SCOPe Domain Sequences for d1uthb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uthb_ c.94.1.1 (B:) LysR-type regulatory protein DntR {Burkholderia sp. [TaxId: 36773]}
alntletalttrdsfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpga
gnlkedmesgavdlalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfsele
hvgvvalntghgevdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcev
pfglttsphpaklpdiainlfwhakynrdpgnmwlrqlfvelfsea

SCOPe Domain Coordinates for d1uthb_:

Click to download the PDB-style file with coordinates for d1uthb_.
(The format of our PDB-style files is described here.)

Timeline for d1uthb_: