Lineage for d1utba_ (1utb A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1624948Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1624949Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1624950Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)
  6. 1625563Protein LysR-type regulatory protein DntR [110748] (1 species)
  7. 1625564Species Burkholderia sp. [TaxId:36773] [110749] (2 PDB entries)
    Uniprot Q7WT50 75-301
  8. 1625567Domain d1utba_: 1utb A: [108030]
    complexed with act, gol

Details for d1utba_

PDB Entry: 1utb (more details), 2.59 Å

PDB Description: dntr from burkholderia sp. strain dnt
PDB Compounds: (A:) LysR-type regulatory protein

SCOPe Domain Sequences for d1utba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utba_ c.94.1.1 (A:) LysR-type regulatory protein DntR {Burkholderia sp. [TaxId: 36773]}
sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfselehvgvvalntghge
vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl
pdiainlfwhakynrdpgnmwlrqlfvelfseah

SCOPe Domain Coordinates for d1utba_:

Click to download the PDB-style file with coordinates for d1utba_.
(The format of our PDB-style files is described here.)

Timeline for d1utba_: