SCOPe 2.08: Domain d1utba1: 1utb A:89-301

Lineage for d1utba1 (1utb A:89-301)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein LysR-type regulatory protein DntR [110748] (1 species)

7. Species Burkholderia sp. [TaxId:36773] [110749] (2 PDB entries)
   Uniprot Q7WT50 75-301

8. Domain d1utba1: 1utb A:89-301 [108030]
   Other proteins in same PDB: d1utba2
   complexed with act, gol

Details for d1utba1

PDB Entry: 1utb, 2.59 Å

PDB Description: dntr from burkholderia sp. strain dnt

PDB Compounds: (A:) LysR-type regulatory protein

SCOPe Domain Sequences for d1utba1:

Sequence; same for both SEQRES and ATOM records:

>d1utba1 c.94.1.1 (A:89-301) LysR-type regulatory protein DntR {Burkholderia sp. [TaxId: 36773]}
sfdpfastrtfnlamtdigemyfmpplmealaqraphiqistlrpnagnlkedmesgavd
lalgllpelqtgffqrrlfrhryvcmfrkdhpsakspmslkqfselehvgvvalntghge
vdglleragikrrmrlvvphfiaigpilhstdliatvpqrfavrcevpfglttsphpakl
pdiainlfwhakynrdpgnmwlrqlfvelfsea

Timeline for d1utba1:

• d1utba1 first appeared in SCOP 1.69, called d1utba_
  
• d1utba1 appears in SCOPe 2.07