Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries) Uniprot P08263 |
Domain d1usbb1: 1usb B:81-219 [108003] Other proteins in same PDB: d1usba2, d1usbb2 complexed with cl, gsh, k |
PDB Entry: 1usb (more details), 2.07 Å
SCOPe Domain Sequences for d1usbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1usbb1 a.45.1.1 (B:81-219) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp gsprkppmdeksleehrki
Timeline for d1usbb1: