Lineage for d1urra_ (1urr A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953323Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) (S)
  5. 2953324Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 2953337Protein Acylphosphatase 2 (Cg18505) [110974] (1 species)
  7. 2953338Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [110975] (1 PDB entry)
    Uniprot Q9VF36
  8. 2953339Domain d1urra_: 1urr A: [107998]
    complexed with gol

Details for d1urra_

PDB Entry: 1urr (more details), 1.5 Å

PDB Description: A novel Drosophila Melanogaster Acylphosphatase (AcPDro2)
PDB Compounds: (A:) cg18505 protein

SCOPe Domain Sequences for d1urra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urra_ d.58.10.1 (A:) Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
vakqifaldfeifgrvqgvffrkhtsheakrlgvrgwcmntrdgtvkgqleapmmnlmem
khwlennripnakvskaefsqiqeiedytftsfdikh

SCOPe Domain Coordinates for d1urra_:

Click to download the PDB-style file with coordinates for d1urra_.
(The format of our PDB-style files is described here.)

Timeline for d1urra_: