![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families) ![]() |
![]() | Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins) automatically mapped to Pfam PF00708 |
![]() | Protein Acylphosphatase 2 (Cg18505) [110974] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [110975] (1 PDB entry) Uniprot Q9VF36 |
![]() | Domain d1urra_: 1urr A: [107998] complexed with gol |
PDB Entry: 1urr (more details), 1.5 Å
SCOPe Domain Sequences for d1urra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urra_ d.58.10.1 (A:) Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} vakqifaldfeifgrvqgvffrkhtsheakrlgvrgwcmntrdgtvkgqleapmmnlmem khwlennripnakvskaefsqiqeiedytftsfdikh
Timeline for d1urra_: