PDB entry 1urr

View 1urr on RCSB PDB site
Description: A novel Drosophila Melanogaster Acylphosphatase (AcPDro2)
Class: hydrolase
Keywords: acylphosphatase, enzyme, hydrolase
Deposited on 2003-11-03, released 2004-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-19, with a file datestamp of 2014-02-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.163
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cg18505 protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1urra_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1urrA (A:)
    magsgvakqifaldfeifgrvqgvffrkhtsheakrlgvrgwcmntrdgtvkgqleapmm
    nlmemkhwlennripnakvskaefsqiqeiedytftsfdikh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1urrA (A:)
    vakqifaldfeifgrvqgvffrkhtsheakrlgvrgwcmntrdgtvkgqleapmmnlmem
    khwlennripnakvskaefsqiqeiedytftsfdikh