Lineage for d1urra_ (1urr A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 504867Superfamily d.58.10: Acylphosphatase-like [54975] (1 family) (S)
  5. 504868Family d.58.10.1: Acylphosphatase-like [54976] (3 proteins)
  6. 504877Protein Acylphosphatase 2 (Cg18505) [110974] (1 species)
  7. 504878Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [110975] (1 PDB entry)
  8. 504879Domain d1urra_: 1urr A: [107998]

Details for d1urra_

PDB Entry: 1urr (more details), 1.5 Å

PDB Description: A novel Drosophila Melanogaster Acylphosphatase (AcPDro2)

SCOP Domain Sequences for d1urra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urra_ d.58.10.1 (A:) Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila melanogaster)}
vakqifaldfeifgrvqgvffrkhtsheakrlgvrgwcmntrdgtvkgqleapmmnlmem
khwlennripnakvskaefsqiqeiedytftsfdikh

SCOP Domain Coordinates for d1urra_:

Click to download the PDB-style file with coordinates for d1urra_.
(The format of our PDB-style files is described here.)

Timeline for d1urra_: