Lineage for d1um2b1 (1um2 B:284-463,B:699-737)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964834Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 964835Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (2 families) (S)
    duplication: contains two intertwined structural repeats
  5. 964840Family b.86.1.2: Intein (protein splicing domain) [51298] (4 proteins)
  6. 964850Protein VMA1-derived endonuclease (VDE) PI-Scei intein [51299] (1 species)
    also contains a homing endonuclease and DNA-binding domains
  7. 964851Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51300] (8 PDB entries)
    Uniprot P17255 284-737
  8. 964861Domain d1um2b1: 1um2 B:284-463,B:699-737 [107949]
    Other proteins in same PDB: d1um2a2, d1um2a3, d1um2b2, d1um2b3
    complexed with the ligated extein segment (Uniprot P17255 281-283,738-741), chains C and D

Details for d1um2b1

PDB Entry: 1um2 (more details), 2.9 Å

PDB Description: crystal structure of the vma1-derived endonuclease with the ligated extein segment
PDB Compounds: (B:) endonuclease pi-scei

SCOPe Domain Sequences for d1um2b1:

Sequence, based on SEQRES records: (download)

>d1um2b1 b.86.1.2 (B:284-463,B:699-737) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnatnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
Xcrgfyfelqelkeddyygitlsddsdhqfllanqvvvhn

Sequence, based on observed residues (ATOM records): (download)

>d1um2b1 b.86.1.2 (B:284-463,B:699-737) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqkellkftc
natnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgrivelvkevsksypiseg
peranelvesyrkasnkayfewtieardlsllgshvrkatyqtyaXcrgfyfelqelked
dyygitlsddsdhqfllanqvvvhn

SCOPe Domain Coordinates for d1um2b1:

Click to download the PDB-style file with coordinates for d1um2b1.
(The format of our PDB-style files is described here.)

Timeline for d1um2b1: