Lineage for d1um2b1 (1um2 B:284-463,B:699-737)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471603Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 471604Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (2 families) (S)
    duplication: contains two intertwined structural repeats
  5. 471609Family b.86.1.2: Intein (protein splicing domain) [51298] (4 proteins)
  6. 471619Protein VMA1-derived endonuclease (VDE) PI-Scei intein [51299] (1 species)
    also contains a homing endonuclease and DNA-binding domains
  7. 471620Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51300] (8 PDB entries)
  8. 471630Domain d1um2b1: 1um2 B:284-463,B:699-737 [107949]
    Other proteins in same PDB: d1um2a2, d1um2a3, d1um2b2, d1um2b3
    complexed with the ligated extein segment (SQ P17255 281-283,738-741), chains C and D

Details for d1um2b1

PDB Entry: 1um2 (more details), 2.9 Å

PDB Description: crystal structure of the vma1-derived endonuclease with the ligated extein segment

SCOP Domain Sequences for d1um2b1:

Sequence, based on SEQRES records: (download)

>d1um2b1 b.86.1.2 (B:284-463,B:699-737) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae)}
sfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqksqhrahk
sdssrevpellkftcnatnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgriv
elvkevsksypisegperanelvesyrkasnkayfewtieardlsllgshvrkatyqtya
Xcrgfyfelqelkeddyygitlsddsdhqfllanqvvvhn

Sequence, based on observed residues (ATOM records): (download)

>d1um2b1 b.86.1.2 (B:284-463,B:699-737) VMA1-derived endonuclease (VDE) PI-Scei intein {Baker's yeast (Saccharomyces cerevisiae)}
sfakgtnvlmadgsiecienievgnkvmgkdgrpreviklprgretmysvvqkellkftc
natnelvvrtprsvrrlsrtikgveyfevitfemgqkkapdgrivelvkevsksypiseg
peranelvesyrkasnkayfewtieardlsllgshvrkatyqtyaXcrgfyfelqelked
dyygitlsddsdhqfllanqvvvhn

SCOP Domain Coordinates for d1um2b1:

Click to download the PDB-style file with coordinates for d1um2b1.
(The format of our PDB-style files is described here.)

Timeline for d1um2b1: