Lineage for d1uiia_ (1uii A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040591Superfamily h.1.28: Geminin coiled-coil domain [111469] (2 families) (S)
  5. 3040592Family h.1.28.1: Geminin coiled-coil domain [111470] (2 proteins)
  6. 3040593Protein Geminin coiled-coil domain [111471] (2 species)
  7. 3040594Species Human (Homo sapiens) [TaxId:9606] [111472] (2 PDB entries)
    Uniprot O75496 70-152
  8. 3040597Domain d1uiia_: 1uii A: [107864]

Details for d1uiia_

PDB Entry: 1uii (more details), 2 Å

PDB Description: Crystal structure of Geminin coiled-coil domain
PDB Compounds: (A:) Geminin

SCOPe Domain Sequences for d1uiia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uiia_ h.1.28.1 (A:) Geminin coiled-coil domain {Human (Homo sapiens) [TaxId: 9606]}
enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym
a

SCOPe Domain Coordinates for d1uiia_:

Click to download the PDB-style file with coordinates for d1uiia_.
(The format of our PDB-style files is described here.)

Timeline for d1uiia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uiib_