PDB entry 1uii

View 1uii on RCSB PDB site
Description: Crystal structure of Geminin coiled-coil domain
Class: Cell Cycle
Keywords: GEMININ, HUMAN, DNA REPLICATION, Cell Cycle
Deposited on 2003-07-16, released 2004-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.216
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geminin
    Species: Homo sapiens [TaxId:9606]
    Gene: GMNN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uiia_
  • Chain 'B':
    Compound: Geminin
    Species: Homo sapiens [TaxId:9606]
    Gene: GMNN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uiib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uiiA (A:)
    pessenknlggvtqesfdlmikenpssqywkevaekrrkalyealkeneklhkeieqkdn
    eiarlkkenkelaevaehvqyma
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uiiA (A:)
    enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uiiB (B:)
    pessenknlggvtqesfdlmikenpssqywkevaekrrkalyealkeneklhkeieqkdn
    eiarlkkenkelaevaehvqyma
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uiiB (B:)
    enpssqywkevaekrrkalyealkeneklhkeieqkdneiarlkkenkelaevaehvqym
    a