Lineage for d1uhd.1 (1uhd B:,A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802650Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)
  6. 2802651Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
    autocatalytic enzyme
  7. 2802670Species Helicobacter pylori [TaxId:210] [110249] (2 PDB entries)
    Uniprot P56065
  8. 2802672Domain d1uhd.1: 1uhd B:,A: [107846]

Details for d1uhd.1

PDB Entry: 1uhd (more details), 2 Å

PDB Description: Crystal structure of aspartate decarboxylase, pyruvoly group bound form
PDB Compounds: (A:) Aspartate 1-decarboxylase alpha chain, (B:) Aspartate 1-decarboxylase beta chain

SCOPe Domain Sequences for d1uhd.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1uhd.1 b.52.2.1 (B:,A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Helicobacter pylori [TaxId: 210]}
mtfemlyskihratitdanlnyigXxitidedlaklaklregmkveivdvnngerfstyv
ilgkkrgeicvngaaarkvaigdvviilayasmnedeinahkpsivlvdekneilekgle
h

SCOPe Domain Coordinates for d1uhd.1:

Click to download the PDB-style file with coordinates for d1uhd.1.
(The format of our PDB-style files is described here.)

Timeline for d1uhd.1: