PDB entry 1uhd

View 1uhd on RCSB PDB site
Description: Crystal structure of aspartate decarboxylase, pyruvoly group bound form
Class: Lyase
Keywords: double-psi beta barrel, Lyase
Deposited on 2003-07-01, released 2004-07-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aspartate 1-decarboxylase alpha chain
    Species: Helicobacter pylori [TaxId:210]
    Gene: PAND
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56065 (0-92)
      • expression tag (93-95)
    Domains in SCOPe 2.08: d1uhd.1
  • Chain 'B':
    Compound: Aspartate 1-decarboxylase beta chain
    Species: Helicobacter pylori [TaxId:210]
    Gene: PAND
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uhd.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhdA (A:)
    xitidedlaklaklregmkveivdvnngerfstyvilgkkrgeicvngaaarkvaigdvv
    iilayasmnedeinahkpsivlvdekneilekgleh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uhdB (B:)
    mtfemlyskihratitdanlnyig