SCOP 1.69: Domain d1uhd.1: 1uhd B:,A:

Lineage for d1uhd.1 (1uhd B:,A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (1 protein)

6. Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
   autocatalytic enzyme

7. Species Helicobacter pylori [TaxId:210] [110249] (2 PDB entries)

8. Domain d1uhd.1: 1uhd B:,A: [107846]

Details for d1uhd.1

PDB Entry: 1uhd, 2 Å

PDB Description: Crystal structure of aspartate decarboxylase, pyruvoly group bound form

SCOP Domain Sequences for d1uhd.1:

Sequence; same for both SEQRES and ATOM records:

>g1uhd.1 b.52.2.1 (B:,A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Helicobacter pylori}
mtfemlyskihratitdanlnyigXsitidedlaklaklregmkveivdvnngerfstyv
ilgkkrgeicvngaaarkvaigdvviilayasmnedeinahkpsivlvdekneilekgle
h

Timeline for d1uhd.1:

• d1uhd.1 is new in SCOP 1.69
  
• d1uhd.1 appears in SCOP 1.71
  
• d1uhd.1 appears in the current release, SCOPe 2.08