Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (32 proteins) |
Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens) [TaxId:9606] [49207] (4 PDB entries) |
Domain d1ugna2: 1ugn A:98-195 [107829] |
PDB Entry: 1ugn (more details), 1.8 Å
SCOP Domain Sequences for d1ugna2:
Sequence, based on SEQRES records: (download)
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens)} ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckegedehpqclnsqphargssra ifsvgpvspsrrwwyrcyaydsnspyewslpsdllell
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens)} ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckeqclnsssraifsvgpvspsrr wwyrcyaydsnspyewslpsdllell
Timeline for d1ugna2: