Lineage for d1ugna2 (1ugn A:98-195)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753822Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2753823Species Human (Homo sapiens) [TaxId:9606] [49207] (5 PDB entries)
    Uniprot Q8NHL6 25-218
  8. 2753827Domain d1ugna2: 1ugn A:98-195 [107829]

Details for d1ugna2

PDB Entry: 1ugn (more details), 1.8 Å

PDB Description: crystal structure of lir1.02, one of the alleles of lir1
PDB Compounds: (A:) leukocyte immunoglobulin-like receptor 1

SCOPe Domain Sequences for d1ugna2:

Sequence, based on SEQRES records: (download)

>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckegedehpqclnsqphargssra
ifsvgpvspsrrwwyrcyaydsnspyewslpsdllell

Sequence, based on observed residues (ATOM records): (download)

>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckeqclnsssraifsvgpvspsrr
wwyrcyaydsnspyewslpsdllell

SCOPe Domain Coordinates for d1ugna2:

Click to download the PDB-style file with coordinates for d1ugna2.
(The format of our PDB-style files is described here.)

Timeline for d1ugna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ugna1