SCOP 1.71: Domain d1ugna2: 1ugn A:98-195

Lineage for d1ugna2 (1ugn A:98-195)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (34 proteins)

6. Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [49207] (4 PDB entries)

8. Domain d1ugna2: 1ugn A:98-195 [107829]
   mutant

Details for d1ugna2

PDB Entry: 1ugn, 1.8 Å

PDB Description: crystal structure of lir1.02, one of the alleles of lir1

SCOP Domain Sequences for d1ugna2:

Sequence, based on SEQRES records:

>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens)}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckegedehpqclnsqphargssra
ifsvgpvspsrrwwyrcyaydsnspyewslpsdllell

Sequence, based on observed residues (ATOM records):

>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens)}
ayikptlsaqpspvvnsggnvtlqcdsqvafdgfilckeqclnsssraifsvgpvspsrr
wwyrcyaydsnspyewslpsdllell

Timeline for d1ugna2:

• d1ugna2 first appeared in SCOP 1.69
  
• d1ugna2 appears in SCOP 1.73
  
• d1ugna2 appears in the current release, SCOPe 2.08