Lineage for d1ue8a_ (1ue8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2004934Protein Cyp119 [48278] (3 species)
    thermophilic P450
  7. 2004952Species Sulfolobus tokodaii [TaxId:111955] [109957] (2 PDB entries)
    Uniprot Q972I2
  8. 2004954Domain d1ue8a_: 1ue8 A: [107781]
    Structural genomics target
    complexed with cl, hem

Details for d1ue8a_

PDB Entry: 1ue8 (more details), 3 Å

PDB Description: Crystal Structure of Thermophilic Cytochrome P450 from Sulfolobus tokodaii
PDB Compounds: (A:) 367aa long hypothetical cytochrome P450

SCOPe Domain Sequences for d1ue8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ue8a_ a.104.1.1 (A:) Cyp119 {Sulfolobus tokodaii [TaxId: 111955]}
mydwfkqmrkespvyydgkvwnlfkyedckmvlndhkrfssnltgyndklemlrsgkvff
diptrytmltsdpplhdelrnltadafnpsnlpvdfvrevtvkllseldeefdviesfai
plpilviskmlginpdvkkvkdwsdlvalrlgradeifsigrkylelisfskkeldsrkg
keivdltgkiansnlselekegyfillmiagnetttnlignaiedftlynswdyvrekga
lkaveealrfsppvmrtirvtkekvkirdqvidegelvrvwiasanrdeevfkdpdsfip
drtpnphlsfgsgihlclgaplarlearialeefakkfrvkeivkkekidnevlngyrkl
vvrvert

SCOPe Domain Coordinates for d1ue8a_:

Click to download the PDB-style file with coordinates for d1ue8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ue8a_: