PDB entry 1ue8

View 1ue8 on RCSB PDB site
Description: Crystal Structure of Thermophilic Cytochrome P450 from Sulfolobus tokodaii
Class: structural genomics, unknown function
Keywords: alpha-domain, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2003-05-09, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.196
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 367aa long hypothetical cytochrome P450
    Species: Sulfolobus tokodaii [TaxId:111955]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q972I2 (0-366)
      • see remark 999 (366)
    Domains in SCOPe 2.07: d1ue8a_
  • Heterogens: CL, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ue8A (A:)
    mydwfkqmrkespvyydgkvwnlfkyedckmvlndhkrfssnltgyndklemlrsgkvff
    diptrytmltsdpplhdelrnltadafnpsnlpvdfvrevtvkllseldeefdviesfai
    plpilviskmlginpdvkkvkdwsdlvalrlgradeifsigrkylelisfskkeldsrkg
    keivdltgkiansnlselekegyfillmiagnetttnlignaiedftlynswdyvrekga
    lkaveealrfsppvmrtirvtkekvkirdqvidegelvrvwiasanrdeevfkdpdsfip
    drtpnphlsfgsgihlclgaplarlearialeefakkfrvkeivkkekidnevlngyrkl
    vvrvert