| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
| Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [111106] (2 PDB entries) Uniprot Q9CQI6 |
| Domain d1udma_: 1udm A: [107780] |
PDB Entry: 1udm (more details)
SCOPe Domain Sequences for d1udma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udma_ d.109.1.2 (A:) Coactosin-like protein Cotl1 (Clp) {Mouse (Mus musculus) [TaxId: 10090]}
gsegaatmatkidkeacraaynlvrddgsaviwvtfrydgativpgdqgadyqhfiqqct
ddvrlfafvrfttgdamskrskfalitwigedvsglqraktgtdktlvkevvqnfakefv
isdrkeleedfirselkkagganydaqse
Timeline for d1udma_: