Lineage for d1udma1 (1udm A:8-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969863Family d.109.1.2: Cofilin-like [55762] (8 proteins)
  6. 2969868Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species)
  7. 2969873Species Mouse (Mus musculus) [TaxId:10090] [111106] (2 PDB entries)
    Uniprot Q9CQI6
  8. 2969874Domain d1udma1: 1udm A:8-149 [107780]
    Other proteins in same PDB: d1udma2

Details for d1udma1

PDB Entry: 1udm (more details)

PDB Description: solution structure of coactosin-like protein (cofilin family) from mus musculus
PDB Compounds: (A:) Coactosin-like protein

SCOPe Domain Sequences for d1udma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udma1 d.109.1.2 (A:8-149) Coactosin-like protein Cotl1 (Clp) {Mouse (Mus musculus) [TaxId: 10090]}
matkidkeacraaynlvrddgsaviwvtfrydgativpgdqgadyqhfiqqctddvrlfa
fvrfttgdamskrskfalitwigedvsglqraktgtdktlvkevvqnfakefvisdrkel
eedfirselkkagganydaqse

SCOPe Domain Coordinates for d1udma1:

Click to download the PDB-style file with coordinates for d1udma1.
(The format of our PDB-style files is described here.)

Timeline for d1udma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1udma2