![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (2 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (7 proteins) |
![]() | Protein Coactosin-like protein Cotl1 (Clp) [111105] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [111106] (1 PDB entry) |
![]() | Domain d1udma_: 1udm A: [107780] |
PDB Entry: 1udm (more details)
SCOP Domain Sequences for d1udma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udma_ d.109.1.2 (A:) Coactosin-like protein Cotl1 (Clp) {Mouse (Mus musculus)} gsegaatmatkidkeacraaynlvrddgsaviwvtfrydgativpgdqgadyqhfiqqct ddvrlfafvrfttgdamskrskfalitwigedvsglqraktgtdktlvkevvqnfakefv isdrkeleedfirselkkagganydaqse
Timeline for d1udma_: