Lineage for d1ua7a1 (1ua7 A:348-425)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804045Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1804046Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1804047Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1804152Protein Bacterial alpha-Amylase [51013] (9 species)
  7. 1804178Species Bacillus subtilis [TaxId:1423] [51016] (2 PDB entries)
    Uniprot P00691
  8. 1804179Domain d1ua7a1: 1ua7 A:348-425 [107759]
    Other proteins in same PDB: d1ua7a2
    complexed with ca

Details for d1ua7a1

PDB Entry: 1ua7 (more details), 2.21 Å

PDB Description: crystal structure analysis of alpha-amylase from bacillus subtilis complexed with acarbose
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1ua7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ua7a1 b.71.1.1 (A:348-425) Bacterial alpha-Amylase {Bacillus subtilis [TaxId: 1423]}
qpeelsnpqgnnqifmnqrgshgvvlanagsssvsintatklpdgrydnkagagsfqvnd
gkltgtinarsvavlypd

SCOPe Domain Coordinates for d1ua7a1:

Click to download the PDB-style file with coordinates for d1ua7a1.
(The format of our PDB-style files is described here.)

Timeline for d1ua7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ua7a2