Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Bacterial alpha-Amylase [51013] (9 species) |
Species Bacillus subtilis [TaxId:1423] [51016] (2 PDB entries) Uniprot P00691 |
Domain d1ua7a1: 1ua7 A:348-425 [107759] Other proteins in same PDB: d1ua7a2 complexed with ca |
PDB Entry: 1ua7 (more details), 2.21 Å
SCOPe Domain Sequences for d1ua7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ua7a1 b.71.1.1 (A:348-425) Bacterial alpha-Amylase {Bacillus subtilis [TaxId: 1423]} qpeelsnpqgnnqifmnqrgshgvvlanagsssvsintatklpdgrydnkagagsfqvnd gkltgtinarsvavlypd
Timeline for d1ua7a1: