SCOP 1.69: Domain d1ua7a1: 1ua7 A:348-425

Lineage for d1ua7a1 (1ua7 A:348-425)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (6 species)

7. Species Bacillus subtilis [TaxId:1423] [51016] (2 PDB entries)

8. Domain d1ua7a1: 1ua7 A:348-425 [107759]
   Other proteins in same PDB: d1ua7a2

Details for d1ua7a1

PDB Entry: 1ua7, 2.21 Å

PDB Description: crystal structure analysis of alpha-amylase from bacillus subtilis complexed with acarbose

SCOP Domain Sequences for d1ua7a1:

Sequence; same for both SEQRES and ATOM records:

>d1ua7a1 b.71.1.1 (A:348-425) Bacterial alpha-Amylase {Bacillus subtilis}
qpeelsnpqgnnqifmnqrgshgvvlanagsssvsintatklpdgrydnkagagsfqvnd
gkltgtinarsvavlypd

Timeline for d1ua7a1:

• d1ua7a1 is new in SCOP 1.69
  
• d1ua7a1 appears in SCOP 1.71
  
• d1ua7a1 appears in the current release, SCOPe 2.08